PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I02434.1.p
Common NameEUGRSUZ_I02434, LOC104419736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 344aa    MW: 38305.8 Da    PI: 8.2354
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I02434.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.91.8e-31126181359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       ++rY+eCl+NhAas+Ggh +DGCgEfmps geegt+  ++CaAC+CHRnFHR+ev+ 
  Eucgr.I02434.1.p 126 SIRYRECLRNHAASMGGHIIDGCGEFMPS-GEEGTPGYFRCAACECHRNFHRKEVDG 181
                       789*************************9.999*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-21122182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.4E-29127179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.9E-28128179IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.399129178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.604.6E-27271341IPR009057Homeodomain-like
SuperFamilySSF466896.16E-17274340IPR009057Homeodomain-like
PROSITE profilePS500718.746277341IPR001356Homeobox domain
TIGRFAMsTIGR015655.6E-26279336IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MELGDLEQER EMPSSLGYTP PHKDSSSKFS AANRRDQTLD QPNHLYPQNH HPPNPHQLAN  60
KPRREYQETD QDPFAVASPS PIAVATGGTS VSIKPHTEPP SPPQGQLTQS PTPQPQSVTA  120
LISTSSIRYR ECLRNHAASM GGHIIDGCGE FMPSGEEGTP GYFRCAACEC HRNFHRKEVD  180
GEPQYTPSLY YSSNKTNGQR AALPPPQHHA IPQPNPINLH HRFSYCISSA ATTTTTMALN  240
QPVMMAFGGG VPEESSSEDL TMIQHSDAVL RSTQLASSKK RFRTKFTQQQ KDKMMECAEK  300
LGWRIQKQDE QEVTQFCAEA GVTRKAFKVW MHNNKQAMKK QQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-212783371675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I02434.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029792.10.0PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A059ASS90.0A0A059ASS9_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s12970.15e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72792543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.18e-57homeobox protein 24